Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000882) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
beta Roll domain anti-HEWL PN715
|
|||||
| Synonyms |
beta Roll domain-based binder PN715
|
|||||
| Molecular Weight | 15.8 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Ribosome display | |||||
| Highest Status | Research | |||||
| Sequence Length | 152 | |||||
| SBP Sequence |
>beta Roll domain anti-HEWL PN715
GSARDDVLIGDAGANVLEGLAGNDVLSGGAGDDHLVGDEGSDLLSGDAGNDYLCGGQGDD TYLFGVGYGHDAISESGGGHDTIRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRD ADHRVEIIHAANQAVDQAGIEKLVEAMAQYPD |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Beta-roll | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS015 | [1] | ||||
| Scaffold Name | Beta Roll domain | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | (Ca2+) + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Hen egg-white lysozyme | Binder | Tools for controlled biomolecular recognition | Kd: 7200 nM | Columbia Universit | [1] | |