General Information of Synthetic Binding Protein (SBP) (ID: SBP000876)
SBP Name
Cytochrome b562-based binder anti-Porphyrin M7A variant
Synonyms
Cytochrome b562-based binder M7A variant
Molecular Weight 11.7 kDa
Thermal Denaturation TEMP 64.2 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Highest Status Research
Sequence Length 106
SBP Sequence
>Cytochrome b562-based binder anti-Porphyrin M7A variant
ADLEDNAETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKD
FRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Cytochrome b562
Protein Scaffold Information of This SBP
Scaffold ID PS024
Scaffold Info
[1]
Scaffold Name Cytochrome b562-based binder
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Porphyrin
BTS Info
Binder Tools as a promising avenue to sustainable hydrogen production Kd: 10800 nM Arizona State University [1]
References
1 Reengineering cyt b562 for hydrogen production: A facile route to artificial hydrogenases. Biochim Biophys Acta. 2016 May;1857(5):598-603.