Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000875) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Cytochrome b562-based binder anti-Porphyrin M7D variant
|
|||||
| Synonyms |
Cytochrome b562-based binder M7D variant
|
|||||
| Molecular Weight | 11.8 kDa | |||||
| Thermal Denaturation TEMP | 64.8 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Highest Status | Research | |||||
| Sequence Length | 106 | |||||
| SBP Sequence |
>Cytochrome b562-based binder anti-Porphyrin M7D variant
ADLEDNDETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKD FRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Cytochrome b562 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS024 | [1] | ||||
| Scaffold Name | Cytochrome b562-based binder | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Porphyrin | Binder | Tools as a promising avenue to sustainable hydrogen production | Kd: 3500 nM | Arizona State University | [1] | |