Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000874)
SBP Name
Cytochrome b562-based binder anti-Zn-Ce6 apo-I17C mutant
Synonyms
Cytochrome b562-based binder apo-I17C mutant
Molecular Weight 11.7 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Highest Status Research
Sequence Length 106
SBP Sequence
>Cytochrome b562-based binder anti-Zn-Ce6 apo-I17C mutant
ADLEDNMETLNDNLKVCEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKD
FRNGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name H63N mutant of Cytochrome b562
Protein Scaffold Information of This SBP
Scaffold ID PS024
Scaffold Info
[1]
Scaffold Name Cytochrome b562-based binder
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Chlorophyll analogue zinc chlorin e6
BTS Info
Binder Research tool Kd: 25 nM Australian National University [1]
References
1 Protein engineering of cytochrome b562 for quinone binding and light-induced electron transfer. Proc Natl Acad Sci U S A. 2004 Dec 21;101(51):17675-80.