Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000807) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
WW domain anti-VEGFR-2 cycB1_4-28
|
|||||
| Synonyms |
WW domain-based binder cycB1_4-28
|
|||||
| Molecular Weight | 4.3 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | CIS display | |||||
| Highest Status | Research | |||||
| Sequence Length | 36 | |||||
| SBP Sequence |
>WW domain anti-VEGFR-2 cycB1_4-28
DCEKLPPGWYKMWSSPGRVLYVNDICHAHRWERPEG |
|||||
| Sequence Description | Cys I and Cys II form disulfide bonds. | |||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Peptide | |||||
| Template Sequence Description | Cys I and Cys II form disulfide bonds in cycB1_4-28; The letter X in the template sequence illustrates the residues that were diversified by mutation in the na?ve WW domain library. | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS067 | [1] | ||||
| Scaffold Name | WW domain | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Vascular endothelial growth factor receptor 2 | Binder | Research tool | Kd: 35 nM | Isogenica Ltd | [1] | |