Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000806) | ||||||
---|---|---|---|---|---|---|
SBP Name |
WW domain anti-VEGFR-2 clone B1
|
|||||
Synonyms |
WW domain-based binder B1
|
|||||
Molecular Weight | 4.5 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | CIS display | |||||
Highest Status | Research | |||||
Sequence Length | 38 | |||||
SBP Sequence |
>WW domain anti-VEGFR-2 clone B1
MADEEKLPPGWYKMWSSPGRVLYVNDITHAHRWERPSG |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Peptide | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS067 | [1] | ||||
Scaffold Name | WW domain | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Vascular endothelial growth factor receptor 2 | Binder | Research tool | Kd: 44 nM | Isogenica Ltd | [1] | |