General Information of Synthetic Binding Protein (SBP) (ID: SBP000805)
SBP Name
WW domain anti-peptide mutant W17F
Synonyms
WW domain mutant W17F
Molecular Weight 7.1 kDa
Thermal Denaturation TEMP 50.3 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Highest Status Research
Sequence Length 57
SBP Sequence
>WW domain anti-peptide mutant W17F
GSQSSFEIPDDVPLPAGFEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSRI
HRD
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name hYAP
Protein Scaffold Information of This SBP
Scaffold ID PS067
Scaffold Info
[1]
Scaffold Name WW domain
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
PY-ligand
BTS Info
Binder Research tool Kd: 15100 nM The Skaggs Institute of Chemical Biology [1]
References
1 Characterization of the structure and function of W --> F WW domain variants: identification of a natively unfolded protein that folds upon ligand binding. Biochemistry. 1999 Oct 26;38(43):14338-51.