Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000805) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
WW domain anti-peptide mutant W17F
|
|||||
| Synonyms |
WW domain mutant W17F
|
|||||
| Molecular Weight | 7.1 kDa | |||||
| Thermal Denaturation TEMP | 50.3 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Highest Status | Research | |||||
| Sequence Length | 57 | |||||
| SBP Sequence |
>WW domain anti-peptide mutant W17F
GSQSSFEIPDDVPLPAGFEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSRI HRD |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | hYAP | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS067 | [1] | ||||
| Scaffold Name | WW domain | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| PY-ligand | Binder | Research tool | Kd: 15100 nM | The Skaggs Institute of Chemical Biology | [1] | |