Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000805) | ||||||
---|---|---|---|---|---|---|
SBP Name |
WW domain anti-peptide mutant W17F
|
|||||
Synonyms |
WW domain mutant W17F
|
|||||
Molecular Weight | 7.1 kDa | |||||
Thermal Denaturation TEMP | 50.3 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Highest Status | Research | |||||
Sequence Length | 57 | |||||
SBP Sequence |
>WW domain anti-peptide mutant W17F
GSQSSFEIPDDVPLPAGFEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSRI HRD |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | hYAP | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS067 | [1] | ||||
Scaffold Name | WW domain | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
PY-ligand | Binder | Research tool | Kd: 15100 nM | The Skaggs Institute of Chemical Biology | [1] | |