Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000799) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
GCN4-based binder anti-IL-4R-alpha 12CMAR-IL4
|
|||||
| Synonyms |
GCN4-based binder 12CMAR-IL4
|
|||||
| Molecular Weight | 3.9 kDa | |||||
| Thermal Denaturation TEMP | 77.8 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| Sequence Length | 31 | |||||
| SBP Sequence |
>GCN4-based binder anti-IL-4R-alpha 12CMAR-IL4
RMKQLEKKVERCLKRNYRLEWEVIRLKKLVG |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | GCN4 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS036 | [1] | ||||
| Scaffold Name | GCN4-based binder | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Two Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Interleukin-4 receptor subunit alpha | Antagonist | Tools for molecular recognition | Kd: 5000 nM | European Molecular Biology Laboratory | [1] | |