Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000798) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
GCN4-based binder anti-HIV-1 C34-GCN4
|
|||||
| Synonyms |
GCN4-based binder C34-GCN4
|
|||||
| Molecular Weight | 4.4 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 37 | |||||
| SBP Sequence |
>GCN4-based binder anti-HIV-1 C34-GCN4
CGGWRMWDLEIKVYTLLIKNLILESEVQQLKNLVELR |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | GCN4 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS036 | [1] | ||||
| Scaffold Name | GCN4-based binder | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Two Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Envelope glycoprotein gp160 | Inhibitor | Human immunodeficiency virus type 1 infection [ICD-11: XN8LD] | IC50: 16 nM | Howard Hughes Medical Institute; Whitehead Institute for Biomedical Research | [1] | |