Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000777) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Designed TPR protein anti-hsp90 CTPR390
|
|||||
| Synonyms |
Designed TPR protein CTPR390
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Highest Status | Research | |||||
| PDB ID | 3KD7 | |||||
| SBP Sequence |
>Designed TPR protein anti-hsp90 CTPR390
GAMDPGNSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQ KAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQNLGNA KQKQG |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | TPR motif | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS030 | [1] | ||||
| Scaffold Name | Designed TPR protein | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Turns | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Heat shock protein HSP 90-beta | Binder | Tools for understanding peptide ligand recognition | Kd: 200000 nM | Yale University | [1] | |