Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000755) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Neocarzinostatin-based binder anti-EtdBr C5-38
|
|||||
| Synonyms |
Neocarzinostatin-based binder C5-38
|
|||||
| Molecular Weight | 10.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 113 | |||||
| SBP Sequence |
>Neocarzinostatin-based binder anti-EtdBr C5-38
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNCPGVSSVTADAN GSASTSLTVRRSFEGGSMVATRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Apo-NCS | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS049 | [1] | ||||
| Scaffold Name | Neocarzinostatin-based binder | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Ethidium bromide | Binder | Tools for increasing calculated maximum change of the total fluorescence intensity | Kd: 15400 nM | Tohoku University | [1] | |