Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000710) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
VNAR anti-AurA D01
|
|||||
| Synonyms |
VNAR D01
|
|||||
| Molecular Weight | 11.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Highest Status | Research | |||||
| PDB ID | 5L8J; 5L8K; 5L8L | |||||
| Sequence Length | 111 | |||||
| SBP Sequence |
>VNAR anti-AurA D01
MARVDQTPRIATKETGESLTINCVLRDTACALDSTNWYRTKLGSTKEQTISIGGRYSETV DEGSNSASLTI RDLRVEDSGTYKCKAIDSCWLSREGAGTVLTVKGGAAALE |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Spotted Wobbegong shark vNAR domain | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS065 | [1] | ||||
| Scaffold Name | vNAR | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Aurora kinase A | Inhibitor | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | Kd: 2000 nM | University of Leeds | [1] | |