Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000710) | ||||||
---|---|---|---|---|---|---|
SBP Name |
VNAR anti-AurA D01
|
|||||
Synonyms |
VNAR D01
|
|||||
Molecular Weight | 11.9 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Highest Status | Research | |||||
PDB ID | 5L8J; 5L8K; 5L8L | |||||
Sequence Length | 111 | |||||
SBP Sequence |
>VNAR anti-AurA D01
MARVDQTPRIATKETGESLTINCVLRDTACALDSTNWYRTKLGSTKEQTISIGGRYSETV DEGSNSASLTI RDLRVEDSGTYKCKAIDSCWLSREGAGTVLTVKGGAAALE |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Spotted Wobbegong shark vNAR domain | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS065 | [1] | ||||
Scaffold Name | vNAR | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Aurora kinase A | Inhibitor | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | Kd: 2000 nM | University of Leeds | [1] | |