General Information of Synthetic Binding Protein (SBP) (ID: SBP000702)
SBP Name
VNAR anti-EphA2 mmE2
Synonyms
VNAR mmE2
Molecular Weight 11.9 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli MBH 71-18
Selection Method Yeast display
Highest Status Research
Sequence Length 110
SBP Sequence
>VNAR anti-EphA2 mmE2
AAARLEQTPTTTTKEAGESLTINCALKGSTYGLGSTYWYFTKKGATKKARLSTGGRYSDT
KNTASKSFSLRISDLRVEDSGTYHCEAKAGHWFNLLHFNIEGGGTTVTVK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS065
Scaffold Info
[1]
Scaffold Name vNAR
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Ephrin type-A receptor 2
BTS Info
Binder Research tool Kd: 482 nM Technical University of Darmstadt [1]
References
1 Shark Attack: high affinity binding proteins derived from shark vNAR domains by stepwise in vitro affinity maturation. J Biotechnol. 2014 Dec 10;191:236-45.