General Information of Synthetic Binding Protein (SBP) (ID: SBP000686)
SBP Name
VNAR anti-Monoclonal antibody 1-A-14
Synonyms
VNAR antibody 1-A-14
Molecular Weight 12. kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli TG1
Selection Method Phage display
Highest Status Research
Sequence Length 111
SBP Sequence
>VNAR anti-Monoclonal antibody 1-A-14
ARVDQTPRTATKETGESLTINCVLRDTSYGLESTGWYRTKLGSTNEQSISIGGRYVETVN
KGSKSFSLRISDLRVEDRGTYKCGASAALSPNSYYCPSCLEKGAGTALTVK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS065
Scaffold Info
[1]
Scaffold Name vNAR
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Monoclonal antibody MAb5G8
BTS Info
Binder Research tool Kd: 46 nM CSIRO Division of Molecular and Health Technologies [1]
References
1 Shark IgNAR antibody mimotopes target a murine immunoglobulin through extended CDR3 loop structures. Proteins. 2008 Apr;71(1):119-30.