Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000680) | ||||||
---|---|---|---|---|---|---|
SBP Name |
scFv anti-VP40 DSTL095
|
|||||
Synonyms |
scFv DSTL095
|
|||||
Molecular Weight | 28.4 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Bacteria | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 270 | |||||
SBP Sequence |
>scFv anti-VP40 DSTL095
MKYLLPTAAAGLLLLAAQPAMADYKDIGLTQSPLTLSVTIGQPASISCKSSQSLLDSDGK TYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQ GTHFPQTFGGGTKLELKRGGGGSGGGGSGGGGSGGGGSEVMLVESGGGLAKPGGSLKLSC AASGFTFSRYGMAWVRQNPEKRLEWVATISGGGSHTYYPDSVKGRFTISRDNAKNNLYLE MSSLRSEDTALYYCTRADYWGQGTTLTVSS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS057 | [1] | ||||
Scaffold Name | scFv | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Matrix protein VP40 | Binder | Tools for detecting Ebolavirus infection | N.A. | Defence Science and Technology Laboratory | [1] | |