Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000669) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
alphaRep protein anti-AlphaRep-bA3-2 clone A3
|
|||||
| Synonyms |
alphaRep protein A3
|
|||||
| Molecular Weight | 22.2 kDa | |||||
| Thermal Denaturation TEMP | >70 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli M15 | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 186 | |||||
| SBP Sequence |
>alphaRep protein anti-AlphaRep-bA3-2 clone A3
ADPEKVEMYIKNLQDDSYYVRRAAAYALGKIGDERAVEPLIKALKDEDAWVRRAAADALG QIGDERAVEPLIKALKDEDGWVRQSAAVALGQIGDERAVEPLIKALKDEDWFVRIAAAFA LGEIGDERAVEPLIKALKDEDGWVRQSAADALGEIGGERVRAAMEKLAETGTGFARKVAV NYLETH |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS009 | [1] , [2] | ||||
| Scaffold Name | Alpha-Rep protein | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| AlphaRep bA3-2 | Binder | Tools for providing the basis of a new generic biosensor design | Kd: 3.7 nM | Institute for Integrative Biology of the Cell (I2BC); Osay Institute of molecular chemistry and materials (ICMMO) | [1] , [2] | |