Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000667) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
alphaRep protein anti-AlphaRep-A3 clone bA3-2
|
|||||
| Synonyms |
alphaRep protein bA3-2
|
|||||
| Molecular Weight | 20.6 kDa | |||||
| Thermal Denaturation TEMP | 84.6 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli M15 | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 4JW2 | |||||
| Sequence Length | 188 | |||||
| SBP Sequence |
>alphaRep protein anti-AlphaRep-A3 clone bA3-2
EKVEMYIKNLQDDSYYVRRAAAYALGKIGDERAVEPLIKALKDEDAWVRRAAADALGQIG DERAVEPLIKALKDEDGWVRQSAAVALGQIGDERAVEPLIKALKDEDWFVRIAAAFALGE IGDERAVEPLIKALKDEDGWVRQSAADALGEIGGERVRAAMEKLAETGTGFARKVAVNYL ETHKSLIS |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS009 | [1] , [2] | ||||
| Scaffold Name | Alpha-Rep protein | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| AlphaRep A3 | Binder | Tools for providing the basis of a new generic biosensor design | Kd: 3.7 nM | Institute of integrated cell biology; Institute of molecular and cellular biochemistry (IBBMC) | [1] , [2] | |
| References |
|---|