Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000624) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Affitin anti-PulD Sac7*41
|
|||||
Synonyms |
Affitin Sac7*41
|
|||||
Molecular Weight | 7.5 kDa | |||||
Thermal Denaturation TEMP | 87.8 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | Ribosome display | |||||
Highest Status | Research | |||||
Sequence Length | 66 | |||||
SBP Sequence |
>Affitin anti-PulD Sac7*41
VKVKFVMSGEEKEVDTSKIMSVVRFGKWVCFRYDDNGKAGYGAVLEKDAPKELLDMLARA EREKKL |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Sac7d | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS007 | [1] , [2] | ||||
Scaffold Name | Affitin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
General secretion pathway protein D | Inhibitor | Tools as probes for conformation change in secretin PulD | Kd: 1.1 nM | Molecular genetics unit | [1] , [2] | |
General secretion pathway protein D | Inhibitor | Tools as probes for conformation change in secretin PulD | Kd: 1.8 nM | Molecular genetics unit | [1] , [2] | |