Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000623) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affitin anti-PulD Sac7*40
|
|||||
| Synonyms |
Affitin Sac7*40
|
|||||
| Molecular Weight | 7.5 kDa | |||||
| Thermal Denaturation TEMP | 84 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Ribosome display | |||||
| Highest Status | Research | |||||
| Sequence Length | 66 | |||||
| SBP Sequence |
>Affitin anti-PulD Sac7*40
VKVKFGEHGEEKEVDTSKIMSVVRFGKWVCFRYDDNGKAGYGAVLEKDAPKELLDMLARA EREKKL |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Sac7d | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS007 | [1] , [2] | ||||
| Scaffold Name | Affitin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| General secretion pathway protein D | Inhibitor | Tools as probes for conformation change in secretin PulD | Kd: 0.9 nM | Molecular genetics unit | [1] , [2] | |
| General secretion pathway protein D | Inhibitor | Tools as probes for conformation change in secretin PulD | Kd: 3.9 nM | Molecular genetics unit | [1] , [2] | |