General Information of Synthetic Binding Protein (SBP) (ID: SBP000621)
SBP Name
Affitin anti-PulD Sac7*33
Synonyms
Affitin Sac7*33
Molecular Weight 7.7 kDa
Thermal Denaturation TEMP 79.2 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Ribosome display
Highest Status Research
Sequence Length 66
SBP Sequence
>Affitin anti-PulD Sac7*33
VKVKFTWYGEEKEVDTSKIMSVCRWGKRVAFSYDDNGKIDYGLVDEKDAPKELLDMLARA
EREKKL
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Sac7d
Protein Scaffold Information of This SBP
Scaffold ID PS007
Scaffold Info
[1] , [2]
Scaffold Name Affitin
Scaffold Class Non-Antibody
Fold Type One Alpha-Helix + Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
General secretion pathway protein D
BTS Info
Inhibitor Tools as probes for conformation change in secretin PulD Kd: 0.17 nM Molecular genetics unit [1] , [2]
General secretion pathway protein D
BTS Info
Inhibitor Tools as probes for conformation change in secretin PulD Kd: 10.4 nM Molecular genetics unit [1] , [2]
References
1 Artificial binding proteins (Affitins) as probes for conformational changes in secretin PulD. J Mol Biol. 2008 Nov 28;383(5):1058-68.
2 Remodeling a DNA-binding protein as a specific in vivo inhibitor of bacterial secretin PulD. Proc Natl Acad Sci U S A. 2007 Nov 13;104(46):17983-8.