Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000598)
SBP Name
Evibody anti-Somatostatin receptor CTLA-4R(cys121)Som1
Synonyms
Evibody CTLA-4R(cys121)Som1
Molecular Weight 14.6 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 135
SBP Sequence
>Evibody anti-Somatostatin receptor CTLA-4R(cys121)Som1
AMHVAQPAVVLASSRGIASFVCEYAAGCKNFFWKTFTSCATEVRVTVLRQADSQVTEVCA
ATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNG
TQIYVIDPEPCPDSD
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name CTLA-4R
Protein Scaffold Information of This SBP
Scaffold ID PS033
Scaffold Info
[1] , [2]
Scaffold Name Evibody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Somatostatin receptor type 1
BTS Info
Activator Alzheimer disease [ICD-11: 8A20] N.A. CRC for Diagnostic Technologies and CSIRO Molecular Science [1] , [2]
References
1 Engineered protein scaffolds for molecular recognition. J Mol Recognit. Jul-Aug 2000;13(4):167-87.
2 Design and expression of soluble CTLA-4 variable domain as a scaffold for the display of functional polypeptides. Proteins. 1999 Aug 1;36(2):217-27.