Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000562) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Cyclotide anti-Abl MTAbl07
|
|||||
Synonyms |
Cyclotide MTAbl07
|
|||||
Molecular Weight | 4.5 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | Bacteria display | |||||
Highest Status | Research | |||||
Sequence Length | 42 | |||||
SBP Sequence |
>Cyclotide anti-Abl MTAbl07
GGVCPKILKKCRRDSDCPGACICRGNGYCGEAIYAAPFARRR |
|||||
Sequence Description | Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds; MTAbl07 is the C-to-N cyclized peptides. | |||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | MCoTI-II | |||||
Template Sequence Description | Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds. | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS023 | [1] | ||||
Scaffold Name | Cyclotide | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Tyrosine-protein kinase ABL1 | Inhibitor | Chronic myeloid leukaemia [ICD-11: 2B33.2] | N.A. | University of Queensland | [1] | |