Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000562)
SBP Name
Cyclotide anti-Abl MTAbl07
Synonyms
Cyclotide MTAbl07
Molecular Weight 4.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Bacteria display
Highest Status Research
Sequence Length 42
SBP Sequence
>Cyclotide anti-Abl MTAbl07
GGVCPKILKKCRRDSDCPGACICRGNGYCGEAIYAAPFARRR
Sequence Description Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds; MTAbl07 is the C-to-N cyclized peptides.
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name MCoTI-II
Template Sequence Description Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds.
Protein Scaffold Information of This SBP
Scaffold ID PS023
Scaffold Info
[1]
Scaffold Name Cyclotide
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tyrosine-protein kinase ABL1
BTS Info
Inhibitor Chronic myeloid leukaemia [ICD-11: 2B33.2] N.A. University of Queensland [1]
References
1 Design of substrate-based BCR-ABL kinase inhibitors using the cyclotide scaffold. Sci Rep. 2015 Aug 12;5:12974.