Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000555) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Knottin anti-Integrin b3I
|
|||||
Synonyms |
Knottin b3I
|
|||||
Molecular Weight | 4.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Pichia pastoris GS115 | |||||
Selection Method | Yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 38 | |||||
SBP Sequence |
>Knottin anti-Integrin b3I
GCVRLHESCLGQQVPCCDPAATCYCRGRGDVKLRCYCR |
|||||
Sequence Description | Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VIII form disulfide bonds; Cys VI and Cys VII form disulfide bonds. | |||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | AgRP | |||||
Template Sequence Description | Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VIII form disulfide bonds; Cys VI and Cys VII form disulfide bonds. | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS042 | [1] | ||||
Scaffold Name | Knottin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Integrin alpha-v-beta-3 | Inhibitor | Tools as inhibitors of platelet aggregation | Kd: 30 nM | Stanford University | [1] | |
Integrin alpha-IIb-beta-3 | Inhibitor | Tools as inhibitors of platelet aggregation | Kd: 70 nM | Stanford University | [1] | |