Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000542)
SBP Name
Knottin anti-Integrin EETI-2.5D
Synonyms
Knottin EETI-2.5D
Molecular Weight 3.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Saccharomyces cerevisiae
Selection Method Yeast display
Highest Status Research
PDB ID 6MSL
Sequence Length 33
SBP Sequence
>Knottin anti-Integrin EETI-2.5D
GCPQGRGDWAPTSCKQDSDCRAGCVCGPNGFCG
Sequence Description Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds.
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name EETI-II
Template Sequence Description Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds.
Protein Scaffold Information of This SBP
Scaffold ID PS042
Scaffold Info
[1]
Scaffold Name Knottin
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Integrin alpha-v-beta-5
BTS Info
Binder Cancers [ICD-11: 2D4Z] N.A. Stanford University [1]
Integrin alpha-v-beta-3
BTS Info
Binder Cancers [ICD-11: 2D4Z] N.A. Stanford University [1]
References
1 Engineered cystine knot peptides that bind alphavbeta3, alphavbeta5, and alpha5beta1 integrins with low-nanomolar affinity. Proteins. 2009 Nov 1;77(2):359-69.