Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000520) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Knottin anti-Matriptase-1 SOTI Var. 1
|
|||||
| Synonyms |
Knottin SOTI Var. 1
|
|||||
| Molecular Weight | 4.0 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 37 | |||||
| SBP Sequence |
>Knottin anti-Matriptase-1 SOTI Var. 1
EDKCSPSGAICSGFGPPEQCCSGACVLNRRARSWRCQ |
|||||
| Sequence Description | Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds. | |||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | SOTI- | |||||
| Template Sequence Description | Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds. | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS042 | [1] | ||||
| Scaffold Name | Knottin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Suppressor of tumorigenicity 14 protein | Inhibitor | Cancers [ICD-11: 2D4Z]; Arthritic | Ki: 28.9 nM | Technical University of Darmstadt | [1] | |