Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000500)
SBP Name
Affibody anti-PDGFRbeta Z02483
Synonyms
Affibody Z02483
Molecular Weight 6.4 kDa
Thermal Denaturation TEMP 30-37 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-PDGFRbeta Z02483
VDNKFNKELVKAAAEIDALPNLNRRQWNAFIKSLVDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Platelet-derived growth factor receptor beta
BTS Info
Binder Imaging agent Kd: 0.4 nM Affibody AB [1]
Platelet-derived growth factor receptor beta
BTS Info
Binder Imaging agent Kd: 6 nM Affibody AB [1]
References
1 Engineered high-affinity affibody molecules targeting platelet-derived growth factor receptor in vivo. J Mol Biol. 2011 Mar 25;407(2):298-315.