Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000472) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affibody anti-CD276 AC12
|
|||||
| Synonyms |
Affibody AC12
|
|||||
| Molecular Weight | 6.3 kDa | |||||
| Thermal Denaturation TEMP | 62.4 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Yeast display and Fluorescence-activated cell sorting | |||||
| Highest Status | Research | |||||
| Sequence Length | 58 | |||||
| SBP Sequence |
>Affibody anti-CD276 AC12
AEAKYAKEKIAALSEIIWLPNLTHGQIMAFIAALNDDPSQSSELLSEAKKLNDSQAPK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Affibody AC2 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS004 | [1] | ||||
| Scaffold Name | Affibody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Three Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| CD276 antigen | Binder | Tumors [ICD-11: XH1N44] | Kd: 0.9 nM | University of Minnesota-Twin Cities | [1] | |