Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000471) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Affibody anti-CD276 AC9
|
|||||
Synonyms |
Affibody AC9
|
|||||
Molecular Weight | 6.4 kDa | |||||
Thermal Denaturation TEMP | 61.5 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Yeast display and Fluorescence-activated cell sorting | |||||
Highest Status | Research | |||||
Sequence Length | 58 | |||||
SBP Sequence |
>Affibody anti-CD276 AC9
AEAKYAKEKIIALSEIIWLPNLTHGQIMAFIAALNDDPSQSSELLSEAKKLNDSQAPK |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Affibody AC2 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS004 | [1] | ||||
Scaffold Name | Affibody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Three Alpha-Helices | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
CD276 antigen | Binder | Tumors [ICD-11: XH1N44] | Kd: 18 nM | University of Minnesota-Twin Cities | [1] | |