General Information of Synthetic Binding Protein (SBP) (ID: SBP000462)
SBP Name
Affibody anti-Taq DNA polymerase Z(TaqS10-7)
Synonyms
Affibody Z(TaqS10-7)
Molecular Weight 6.6 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli RV308
Selection Method Phage display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-Taq DNA polymerase Z(TaqS10-7)
VDNKFNKELGWATWEIPNLPNLNGQQVRAFIHSLRDDRSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Taq DNA polymerase
BTS Info
Binder Tools for affinity maturation of a Taq DNA polymerase specific affibody by helix shuffling Kd: 37 nM Royal Institute of Technology [1]
References
1 Affinity maturation of a Taq DNA polymerase specific affibody by helix shuffling. Protein Eng. 1999 Oct;12(10):873-8.