Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000455) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Affibody anti-fVIII Z(fVIII mat.?28)
|
|||||
Synonyms |
Affibody Z(fVIII mat.?28)
|
|||||
Molecular Weight | 6.7 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 58 | |||||
SBP Sequence |
>Affibody anti-fVIII Z(fVIII mat.?28)
VDNKFNKEWRDAWVEIKTLPNLNWYQRRAFIGSLLDDPSQSANLLAEAKKLNDAQAPK |
|||||
3D Structure |
|
|||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Z domain of staphylococcal protein A | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS004 | [1] | ||||
Scaffold Name | Affibody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Three Alpha-Helices | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Coagulation factor VIII | Binder | Tools as an substitute for monoclonal antibodies in purification processes; Diagnostic reagent | Kd: 5-10 nM | Royal Institute of Technology | [1] | |