General Information of Synthetic Binding Protein (SBP) (ID: SBP000455)
SBP Name
Affibody anti-fVIII Z(fVIII mat.?28)
Synonyms
Affibody Z(fVIII mat.?28)
Molecular Weight 6.7 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Phage display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-fVIII Z(fVIII mat.?28)
VDNKFNKEWRDAWVEIKTLPNLNWYQRRAFIGSLLDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Coagulation factor VIII
BTS Info
Binder Tools as an substitute for monoclonal antibodies in purification processes; Diagnostic reagent Kd: 5-10 nM Royal Institute of Technology [1]
References
1 Recombinant human factor VIII-specific affinity ligands selected from phage-displayed combinatorial libraries of protein A. Eur J Biochem. 2001 Aug;268(15):4269-77.