Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000413) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Centyrin anti-HGFR P114-A3
|
|||||
| Synonyms |
Centyrin P114-A3
|
|||||
| Molecular Weight | 9.6 kDa | |||||
| Thermal Denaturation TEMP | 45.6-87.3 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | CIS display | |||||
| Highest Status | Research | |||||
| Sequence Length | 89 | |||||
| SBP Sequence |
>Centyrin anti-HGFR P114-A3
LPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWIRYFEFLGSGEAIVLTVPGSERSYDLTG LKPGTEYVVNIMGVKGGKISPPLSAIFTT |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Tencon | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS020 | [1] | ||||
| Scaffold Name | Centyrin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Hepatocyte growth factor receptor | Inhibitor | Research tool | Kd: 0.4 nM | Janssen Research & Development, L.L.C. | [1] | |