Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000411) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Repebody anti-ERBB1 rEgH9CCaaX
|
|||||
| Synonyms |
Repebody rEgH9CCaaX
|
|||||
| Molecular Weight | 27.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| Sequence Length | 252 | |||||
| SBP Sequence |
>Repebody anti-ERBB1 rEgH9CCaaX
ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQ YLPNVRMLHLPSNKLHDISALKELTNLTYLMLHYNQLQILPNGVFDKLTNLKELYLSENQ LQSLPDGVFDKLTNLTELDLARNQLQSLPKGVFDKLTQLKDLRLYENQLKSVPDGVFDRL TSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVRNSAGSVAPDSAKCSGSGKPVRSIICP TGGGGGGGCVIM |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS055 | [1] | ||||
| Scaffold Name | Repebody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Epidermal growth factor receptor | Binder | Targeted therapies | Kd: 0.3 nM | Korea Advanced Institute of Science and Technology (KAIST) | [1] | |