Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000408) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Repebody anti-Btk rF10
|
|||||
| Synonyms |
Repebody rF10
|
|||||
| Molecular Weight | 31.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli Origami (DE3) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 6HTF | |||||
| Sequence Length | 274 | |||||
| SBP Sequence |
>Repebody anti-Btk rF10
ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQ YLPNVRYLALGGYKLHDISALKELTNLTYLELIYNQLQSLPNGVFDKLTNLKELVLYWNQ LQSLPDGVFDKLTNLTYLYLQRNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKL TQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRN SAGSVAPDSAKCSGSGKPVRSIICPTLEHHHHHH |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS055 | [1] | ||||
| Scaffold Name | Repebody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Tyrosine-protein kinase BTK | Inhibitor | X-linked agammaglobulinemia (XLA) [ICD-11: 4A01.01] | Kd: 15 nM | Swiss federal Institute of Technology in Lausanne | [1] | |