Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000400) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Repebody anti-IL-6 F11
|
|||||
| Synonyms |
Repebody F11
|
|||||
| Molecular Weight | 29.7 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 266 | |||||
| SBP Sequence |
>Repebody anti-IL-6 F11
ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQ YLPNVRYLALGGNKLHDISALKELTNLTYLTLEPNQLQSLPNGVFDKLTNLKELSLWMNQ LQSLPDGVFDKLTNLTYLNLAHNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKL TQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRN SAGSVAPDSAKCSGSGKPVRSIICPT |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Repebody | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS055 | [1] | ||||
| Scaffold Name | Repebody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Interleukin-6 | Binder | Research tool | Kd: 117 nM | Korea Advanced Institute of Science and Technology (KAIST) | [1] | |