Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000394) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Repebody anti-IL-6 r-D3E8
|
|||||
Synonyms |
Repebody r-D3E8
|
|||||
Molecular Weight | 29.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
PDB ID | 4J4L | |||||
Sequence Length | 261 | |||||
SBP Sequence |
>Repebody anti-IL-6 r-D3E8
PIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRY LALGGNKLHDISALKELTNLTYLTLEPNQLQSLPNGVFDKLTNLKELQLWANQLQSLPDG VFDKLTNLTYLNLAFNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPKGVFDKLTQLKDLR LYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAP DSAKCSGSGKPVRSIICPTLE |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS055 | [1] | ||||
Scaffold Name | Repebody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Interleukin-6 | Blocker | Non-small cell lung cancer [ICD-11: 2C25.Y] | Kd: 2.5 nM | Korea Advanced Institute of Science and Technology (KAIST) | [1] | |