Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000394) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Repebody anti-IL-6 r-D3E8
|
|||||
| Synonyms |
Repebody r-D3E8
|
|||||
| Molecular Weight | 29.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 4J4L | |||||
| Sequence Length | 261 | |||||
| SBP Sequence |
>Repebody anti-IL-6 r-D3E8
PIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRY LALGGNKLHDISALKELTNLTYLTLEPNQLQSLPNGVFDKLTNLKELQLWANQLQSLPDG VFDKLTNLTYLNLAFNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPKGVFDKLTQLKDLR LYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAP DSAKCSGSGKPVRSIICPTLE |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS055 | [1] | ||||
| Scaffold Name | Repebody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Interleukin-6 | Blocker | Non-small cell lung cancer [ICD-11: 2C25.Y] | Kd: 2.5 nM | Korea Advanced Institute of Science and Technology (KAIST) | [1] | |