Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000389) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affilin anti-IgG-Fc SPC-1-A1
|
|||||
| Synonyms |
Affilin SPC-1-A1
|
|||||
| Molecular Weight | 21.9 kDa | |||||
| Thermal Denaturation TEMP | 56 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 182 | |||||
| SBP Sequence |
>Affilin anti-IgG-Fc SPC-1-A1
GFIWFMEDRAFQGRRYDCGTDCPNLQPYFSRCNSIKVKSGCWMIYERPNYQGHQYFLRRG EYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCLSVQDRFHLTE IHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLYLEHHHH HH |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Gamma-B-crystallin | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS005 | [1] | ||||
| Scaffold Name | Affilin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Beta-Turns + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Fc fragment of human immunoglobulin G | Binder | Research tool | Kd: 230 nM | Scil Proteins GmbH | [1] | |