Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000386) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Affilin anti-proNGF SPC-7-E9
|
|||||
Synonyms |
Affilin SPC-7-E9
|
|||||
Molecular Weight | 21.7 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 182 | |||||
SBP Sequence |
>Affilin anti-proNGF SPC-7-E9
GFICFLEDRAFQGRSYACDTDCPNLQPYFSRCNSISVLSGCWMIYERPNYQGHQYFLRRG EYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCLSVQDRFHLTE IHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLYLEHHHH HH |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Gamma-B-crystallin | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS005 | [1] | ||||
Scaffold Name | Affilin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Beta-Turns + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
pro-form of nerve growth factor | Binder | Research tool | Kd: 6 nM | Scil Proteins GmbH | [1] | |