General Information of Synthetic Binding Protein (SBP) (ID: SBP000386)
SBP Name
Affilin anti-proNGF SPC-7-E9
Synonyms
Affilin SPC-7-E9
Molecular Weight 21.7 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 182
SBP Sequence
>Affilin anti-proNGF SPC-7-E9
GFICFLEDRAFQGRSYACDTDCPNLQPYFSRCNSISVLSGCWMIYERPNYQGHQYFLRRG
EYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCLSVQDRFHLTE
IHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLYLEHHHH
HH
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Gamma-B-crystallin
Protein Scaffold Information of This SBP
Scaffold ID PS005
Scaffold Info
[1]
Scaffold Name Affilin
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Beta-Turns + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
pro-form of nerve growth factor
BTS Info
Binder Research tool Kd: 6 nM Scil Proteins GmbH [1]
References
1 Affilin-novel binding molecules based on human gamma-B-crystallin, an all beta-sheet protein. J Mol Biol. 2007 Sep 7;372(1):172-85.