Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000384) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
OBody anti-HEWL AM3L15
|
|||||
| Synonyms |
OBody AM3L15
|
|||||
| Molecular Weight | 12.4 kDa | |||||
| Thermal Denaturation TEMP | 66.4 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli DH5 (alpha) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 4GN5 | |||||
| Sequence Length | 113 | |||||
| SBP Sequence |
>OBody anti-HEWL AM3L15
VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTP DHLFKVFAELSREDVVVIKGIVEAGWPVALDTGVEIFPSEIWILNKAKPLPID |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | OBody NL8 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS050 | [1] | ||||
| Scaffold Name | OBody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Hen egg-white lysozyme | Inhibitor | Tools for molecular recognition | Kd: 30 nM | University of Waikato; OBodies Limited | [1] | |