Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000368) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affimer anti-K6-diubiquitin
|
|||||
| Synonyms |
Affimer K6
|
|||||
| Molecular Weight | 13.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 5OHL | |||||
| Sequence Length | 116 | |||||
| SBP Sequence |
>Affimer anti-K6-diubiquitin
MSAATGVRAVPGNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQSWKDDELFDTM YYLTLEAKDGGKKKLYEAKVWVKASGIVMYQMNFKELQEFKPVGDAAAAHHHHHHG |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Adhiron | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS006 | [1] | ||||
| Scaffold Name | Affimer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets+ Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| K6 diubiquitin | Binder | Tools for studying ubiquitin chain types | Kd: 0.02 nM | Division of Protein and Nucleic Acid Chemistry, MRC Laboratory of Molecular Biology | [1] | |