Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000353) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affimer anti-ySUMO clone 10
|
|||||
| Synonyms |
Ad-ySUMO 10
|
|||||
| Molecular Weight | 11.7 kDa | |||||
| Thermal Denaturation TEMP | 95.2 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 103 | |||||
| SBP Sequence |
>Affimer anti-ySUMO clone 10
ATGVRAVPGNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIIIHENDADTMYYL TLEAKDGGKKKLYEAKVWVKGIMDGLNKYNFKELQEFKPVGDA |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Adhiron92 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS006 | [1] | ||||
| Scaffold Name | Affimer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets+ Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Yeast small ubiquitin-related modifier | Binder | Tools for molecular recognition | Kd: 29.6 nM | University of Leeds | [1] | |