General Information of Synthetic Binding Protein (SBP) (ID: SBP000346)
SBP Name
ABD-derived affinity protein anti-ERBB2/HSA clone FACS-12
Synonyms
ADAPT(ERBB2-FACS-12)
Molecular Weight 5.2 kDa
Thermal Denaturation TEMP 63 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display, Staphylococcal surface display and Flow cytomety
Highest Status Research
Sequence Length 46
SBP Sequence
>ABD-derived affinity protein anti-ERBB2/HSA clone FACS-12
LAPAKETVLYHLDRLGVSDYYKDLIDKAKTVEGVKALYFEILRALP
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Albumin-binding domain (ABD)
Protein Scaffold Information of This SBP
Scaffold ID PS001
Scaffold Info
[1]
Scaffold Name ABD-derived affinity protein
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Receptor tyrosine-protein kinase erbB-2
BTS Info
Binder Cancers [ICD-11: 2D4Z] Kd: 0.3 nM KTH Royal Institute of Technology [1]
Albumin
BTS Info
Binder Cancers [ICD-11: 2D4Z] Kd: 1 nM KTH Royal Institute of Technology [1]
References
1 Engineering of bispecific affinity proteins with high affinity for ERBB2 and adaptable binding to albumin. PLoS One. 2014 Aug 4;9(8):e103094.