Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000343) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
ABD-derived affinity protein anti-ERBB2/HSA clone FACS-4
|
|||||
| Synonyms |
ADAPT(ERBB2-FACS-4)
|
|||||
| Molecular Weight | 5.2 kDa | |||||
| Thermal Denaturation TEMP | 62 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display, Staphylococcal surface display and Flow cytomety | |||||
| Highest Status | Research | |||||
| Sequence Length | 46 | |||||
| SBP Sequence |
>ABD-derived affinity protein anti-ERBB2/HSA clone FACS-4
LAPAKETALYHLDRLGVSDYYKDLIDKAKTVEGVKALYFEILHALP |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Albumin-binding domain (ABD) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS001 | [1] | ||||
| Scaffold Name | ABD-derived affinity protein | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Three Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Receptor tyrosine-protein kinase erbB-2 | Binder | Cancers [ICD-11: 2D4Z] | Kd: 0.6 nM | KTH Royal Institute of Technology | [1] | |
| Albumin | Binder | Cancers [ICD-11: 2D4Z] | Kd: 0.6 nM | KTH Royal Institute of Technology | [1] | |