General Information of Synthetic Binding Protein (SBP) (ID: SBP000240)
SBP Name
DARPin anti-MG FADA-3210
Synonyms
DARPin FADA-3210
Molecular Weight 17.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli XL1-Blue
Selection Method Ribosome display; Yeast display
Highest Status Research
Sequence Length 159
SBP Sequence
>DARPin anti-MG FADA-3210
GSDLGKKLLEAARAGQDDEVRILMANGADVNAKDSRGKTPLHLAADYGYLEVAEVLLKHG
ADVNAHDVYGDTPLHLTATWGHLEIVEVLLKNGADANAIDFFGWTPLHLAAYFGHLEIVE
VLLKYGADVNAQDKFGKTVFDISVYNGDEDLAEILQKLN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Malachite green
BTS Info
Binder Imaging agent Kd: 50-150 nM University of Zurich [1]
References
1 Generation of Fluorogen-Activating Designed Ankyrin Repeat Proteins (FADAs) as Versatile Sensor Tools. J Mol Biol. 2016 Mar 27;428(6):1272-1289.