Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000236) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Avimer anti-CII M26
|
|||||
| Synonyms |
Avimer M26
|
|||||
| Molecular Weight | 4.6 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 42 | |||||
| SBP Sequence |
>Avimer anti-CII M26
CMPNQFKCRSSRTCLLPEWVCDGIDDCPDGSDESPTNCPTPT |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS014 | [1] | ||||
| Scaffold Name | Avimer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | (Ca2+) + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Collagen alpha-1(II) chain | Binder | Research tool | Kd: 0.18 nM | Avidia | [1] | |