Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000233) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Avimer anti-FGFR1c/KLB C3209
|
|||||
| Synonyms |
Avimer C3209
|
|||||
| Molecular Weight | 14.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 135 | |||||
| SBP Sequence |
>Avimer anti-FGFR1c/KLB C3209
CGEGLFTCRSTNICISHAWVCDGVDDCEDNSDENNCSAPASEPPGSLCGADQFRCGNGSC VPRAWRCDGVDDCGDGSDEAPEICETPTCQSNEFRCRSGRCIPQHWLCDGLNDCGDGSDE SQQCSAPASEPPGSL |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS014 | [1] | ||||
| Scaffold Name | Avimer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | (Ca2+) + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Fibroblast growth factor receptor 1 | Agonist | Diabetes [ICD-11: 5A14]; Obesity [ICD-11: 5B81.Z] | N.A. | Amgen | [1] | |
| Beta-klotho | Agonist | Diabetes [ICD-11: 5A14]; Obesity [ICD-11: 5B81.Z] | N.A. | Amgen | [1] | |