Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000223) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Peptide aptamer anti-TiO2 Dps-ST1
|
|||||
| Synonyms |
Peptide aptamer Dps-ST1
|
|||||
| Molecular Weight | 19.6 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 169 | |||||
| SBP Sequence |
>Peptide aptamer anti-TiO2 Dps-ST1
MKTINSVDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEV AERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTLELLRDEYKQGIELT DKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLEMAYPQKFNNNFMS |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS051 | [1] | ||||
| Scaffold Name | Peptide aptamer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| TiO2 | Binder | Research tool | Kd: 28 nM | Ajinomoto Co., Inc | [1] | |