Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000199) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Peptide aptamer anti-Id clone 10
|
|||||
| Synonyms |
PA10
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Bacteria | |||||
| Selection Method | Yeast two-hybrid screen | |||||
| Highest Status | Research | |||||
| SBP Sequence |
>Inserted sequence
VGCGSVASSFVSCCAFWACGGSVQNDRPDSG |
|||||
| Template Name | Thioredoxin (TrxA) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS051 | [1] , [2] | ||||
| Scaffold Name | Peptide aptamer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Inhibitor of differentiation or DNA binding protein | Binder | Breast cancer [ICD-11: 2C6Z] | N.A. | German Cancer Research Center | [1] , [2] | |
| References |
|---|