Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000108)
SBP Name
Anticalin anti-Fibronectin N10D
Synonyms
Anticalin N10D
Molecular Weight 20.6 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Phage display
Highest Status Research
Sequence Length 178
SBP Sequence
>Anticalin anti-Fibronectin N10D
QDSTSDLIPAPPLSKVPLQQNFQDNQFHGKWYVVGAAGNTWLREDKDPYKMQATIYELKE
DKSYNVTNVLFMSKKCRYMIHTFVPGSQPGEFTLGSIKSWPGLTSWLVRVVSTNYNQHAM
VFFKRVYQNREFFGITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Lipocalin 2 (Lcn2)
Protein Scaffold Information of This SBP
Scaffold ID PS011
Scaffold Info
[1] , [2] , [3]
Scaffold Name Anticalin
Scaffold Class Non-Antibody
Fold Type One Alpha-Helix + Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Fibronectin
BTS Info
Binder Glioblastoma, primary [ICD-11: XH0MB1] Kd: 40.4 nM Technical University of Munich [1] , [2] , [3]
Fibronectin
BTS Info
Binder Glioblastoma, primary [ICD-11: XH0MB1] N.A. Technical University of Munich [1] , [2] , [3]
References
1 Recent advances in the development of novel protein scaffolds based therapeutics. Int J Biol Macromol. 2017 Sep;102:630-641.
2 Anticalins directed against the fibronectin extra domain B as diagnostic tracers for glioblastomas. Int J Cancer. 2016 Mar 1;138(5):1269-80.
3 Combinatorial design of an Anticalin directed against the extra-domain b for the specific targeting of oncofetal fibronectin. J Mol Biol. 2013 Feb 22;425(4):780-802.