Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000105) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Anticalin anti-Fibronectin N7A
|
|||||
Synonyms |
Anticalin N7A
|
|||||
Molecular Weight | 20.8 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
PDB ID | 4GH7 | |||||
Sequence Length | 178 | |||||
SBP Sequence |
>Anticalin anti-Fibronectin N7A
QDSTSDLIPAPPLSKVPLQQNFQDNQFHGKWYVVGKAGNHDLREDKDPRKMQATIYELKE DKSYNVTNVRFVHKKCNYRIWTFVPGSQPGEFTLGNIKSWPGLTSWLVRVVSTNYNQHAM VFFKRVYQNRELFEITLYGRTKELTNELKENFIRFSKSLGLPENHIVFPVPIDQCIDG |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Lipocalin 2 (Lcn2) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS011 | [1] , [2] , [3] | ||||
Scaffold Name | Anticalin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Fibronectin | Binder | Glioblastoma, primary [ICD-11: XH0MB1] | Kd: 5.8 nM | Technical University of Munich | [1] , [2] , [3] | |
Fibronectin | Binder | Glioblastoma, primary [ICD-11: XH0MB1] | Kd: 119 nM | Technical University of Munich | [1] , [2] , [3] | |
References |
---|