Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000104) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Anticalin anti-BzBuPht PhtC
|
|||||
| Synonyms |
Anticalin PhtC
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli JM83 | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| SBP Sequence |
>Anticalin anti-BzBuPht PhtC
NVYHDGACPEVKPVDNFDWSNYHGKWWEVAKYPWTSNKYGKCGWAEYTPEGKSVKVSPYP VIHGKEYFREGTAYPVGDSKIGKIYHKRTVGGGTAEWVFNVLSTDNKNYIIGYFCFYDED KKGHLDTVWVLSRSKVLTGEAKTAVENYLIGSPVVDSQKLVYSDFSEAACKVN |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Bilin-binding protein | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS011 | [1] | ||||
| Scaffold Name | Anticalin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Benzyl butyl phthalate | Binder | Tools as a reagent specificity for a nonsymmetric phthalic acid ester | Kd: 11600 nM | Technical University of Munich | [1] | |